Guinea Pig Interleukin 17 Protein

Guinea Pig Interleukin 17 Protein

  • $ 750.00
    Unit price per 


Guinea Pig (Cavia porcellus) Interleukin 17A protein.  This protein was purified from transient expression in Human embryonic kidney 293 cells.  The mature protein represents amino acids 25-158 of NP_001265697.1; Uniprot A0A286XFR9 and includes six additional amino acids from an HRV3C cleavage site on the C-terminal end.  Two distinct bands of approximately 5kDa difference in size are observed on reduced SDS-Page due to a heterogeneous population of N-linked glycosylated protein.

 

Molecular Weight 15.8 kDa

 

Sequence of Mature Protein           

GIPIPRNPGCPTATEGKNFLQNVKLNLSIFNPLTQN

VNSRRSSDYYKRSTSPWTLHRNENPNRYPPVIWEAECRYSGCVNAAGKEDHHVSSVPIQQ

EILVLQREPQNCPLSFRLEKMKVTVGCTCVTPIVRHVG LEVLFQ

Click here for a sample data sheet